Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
Protein automated matches [190669] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187771] (2 PDB entries) |
Domain d2gtra_: 2gtr A: [164842] automated match to d2fw2a1 |
PDB Entry: 2gtr (more details), 1.9 Å
SCOPe Domain Sequences for d2gtra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgsvf ccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasilpl cdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgkgl vsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkkiwg saqgmdsmlkylqrkide
Timeline for d2gtra_: