Lineage for d2grkb1 (2grk B:8-231)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387919Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387920Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) (S)
    automatically mapped to Pfam PF02250
  5. 2387921Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)
  6. 2387926Protein automated matches [190665] (2 species)
    not a true protein
  7. 2387927Species Ectromelia virus [TaxId:265874] [187767] (1 PDB entry)
  8. 2387929Domain d2grkb1: 2grk B:8-231 [164824]
    Other proteins in same PDB: d2grka2, d2grkb2
    automated match to d1cq3a_

Details for d2grkb1

PDB Entry: 2grk (more details), 2.6 Å

PDB Description: crystal structure of ectromelia virus evm1 chemokine binding protein
PDB Compounds: (B:) evm001

SCOPe Domain Sequences for d2grkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grkb1 b.27.1.1 (B:8-231) automated matches {Ectromelia virus [TaxId: 265874]}
sfasscteeennhhmgidviikvtkqdqtptndkicqsvtevteseddgvseevvkgdpt
tyytvvggglrmnfgftkcpqiksisesadgntvnarlssvspmygiespaitheealam
indcavsinikcseeekdsnikthpvlgsnishkkvryediigstivdikcvkdlefsvr
igdmckeaselevkdgfkyidgsvsegatddtslidstklkacv

SCOPe Domain Coordinates for d2grkb1:

Click to download the PDB-style file with coordinates for d2grkb1.
(The format of our PDB-style files is described here.)

Timeline for d2grkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2grkb2