Class b: All beta proteins [48724] (178 folds) |
Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) automatically mapped to Pfam PF02250 |
Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins) |
Protein automated matches [190665] (2 species) not a true protein |
Species Ectromelia virus [TaxId:265874] [187767] (1 PDB entry) |
Domain d2grkb1: 2grk B:8-231 [164824] Other proteins in same PDB: d2grka2, d2grkb2 automated match to d1cq3a_ |
PDB Entry: 2grk (more details), 2.6 Å
SCOPe Domain Sequences for d2grkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grkb1 b.27.1.1 (B:8-231) automated matches {Ectromelia virus [TaxId: 265874]} sfasscteeennhhmgidviikvtkqdqtptndkicqsvtevteseddgvseevvkgdpt tyytvvggglrmnfgftkcpqiksisesadgntvnarlssvspmygiespaitheealam indcavsinikcseeekdsnikthpvlgsnishkkvryediigstivdikcvkdlefsvr igdmckeaselevkdgfkyidgsvsegatddtslidstklkacv
Timeline for d2grkb1: