SCOPe 2.01: Domain d2grkb_: 2grk B:

Lineage for d2grkb_ (2grk B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family)

5. Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)

6. Protein automated matches [190665] (1 species)
   not a true protein

7. Species Ectromelia virus [TaxId:265874] [187767] (1 PDB entry)

8. Domain d2grkb_: 2grk B: [164824]
   automated match to d1cq3a_

Details for d2grkb_

PDB Entry: 2grk, 2.6 Å

PDB Description: crystal structure of ectromelia virus evm1 chemokine binding protein

PDB Compounds: (B:) evm001

SCOPe Domain Sequences for d2grkb_:

Sequence; same for both SEQRES and ATOM records:

>d2grkb_ b.27.1.1 (B:) automated matches {Ectromelia virus [TaxId: 265874]}
sfasscteeennhhmgidviikvtkqdqtptndkicqsvtevteseddgvseevvkgdpt
tyytvvggglrmnfgftkcpqiksisesadgntvnarlssvspmygiespaitheealam
indcavsinikcseeekdsnikthpvlgsnishkkvryediigstivdikcvkdlefsvr
igdmckeaselevkdgfkyidgsvsegatddtslidstklkacvgslv

Timeline for d2grkb_:

• d2grkb_ is new in SCOPe 2.01-stable
  
• d2grkb_ appears in SCOPe 2.02
  
• d2grkb_ appears in the current release, SCOPe 2.08, called d2grkb1