| Class b: All beta proteins [48724] (174 folds) |
| Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) ![]() |
| Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins) |
| Protein automated matches [190665] (1 species) not a true protein |
| Species Ectromelia virus [TaxId:265874] [187767] (1 PDB entry) |
| Domain d2grkb_: 2grk B: [164824] automated match to d1cq3a_ |
PDB Entry: 2grk (more details), 2.6 Å
SCOPe Domain Sequences for d2grkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grkb_ b.27.1.1 (B:) automated matches {Ectromelia virus [TaxId: 265874]}
sfasscteeennhhmgidviikvtkqdqtptndkicqsvtevteseddgvseevvkgdpt
tyytvvggglrmnfgftkcpqiksisesadgntvnarlssvspmygiespaitheealam
indcavsinikcseeekdsnikthpvlgsnishkkvryediigstivdikcvkdlefsvr
igdmckeaselevkdgfkyidgsvsegatddtslidstklkacvgslv
Timeline for d2grkb_: