![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins) in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker |
![]() | Protein automated matches [190663] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187763] (1 PDB entry) |
![]() | Domain d2gpea_: 2gpe A: [164790] automated match to d2ay0a1 complexed with imd |
PDB Entry: 2gpe (more details), 1.9 Å
SCOPe Domain Sequences for d2gpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpea_ a.43.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]} gtttmgvklddatreriksaatridrtphwlikqaifsyleqlensd
Timeline for d2gpea_: