Lineage for d2gpeb_ (2gpe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712770Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
    in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker
  6. 2712781Protein automated matches [190663] (2 species)
    not a true protein
  7. 2712782Species Escherichia coli [TaxId:562] [187763] (1 PDB entry)
  8. 2712784Domain d2gpeb_: 2gpe B: [164791]
    automated match to d2ay0a1
    complexed with imd

Details for d2gpeb_

PDB Entry: 2gpe (more details), 1.9 Å

PDB Description: Structure of the DNA-binding domain of E. Coli Proline Utilization A (PUTA)
PDB Compounds: (B:) Bifunctional protein putA

SCOPe Domain Sequences for d2gpeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpeb_ a.43.1.11 (B:) automated matches {Escherichia coli [TaxId: 562]}
gtttmgvklddatreriksaatridrtphwlikqaifsyleqlens

SCOPe Domain Coordinates for d2gpeb_:

Click to download the PDB-style file with coordinates for d2gpeb_.
(The format of our PDB-style files is described here.)

Timeline for d2gpeb_: