Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (4 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [187754] (1 PDB entry) |
Domain d2gj3a_: 2gj3 A: [164728] automated match to d1n9na_ complexed with eoh, fad, so4 |
PDB Entry: 2gj3 (more details), 1.04 Å
SCOPe Domain Sequences for d2gj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj3a_ d.110.3.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]} llpeifrqtvehapiaisitdlkanilyanrafrtitgygseevlgknesilsngttprl vyqalwgrlaqkkpwsgvlvnrrkdktlylaeltvapvlneagetiyylgmhrdtselh
Timeline for d2gj3a_: