Lineage for d2gj3a_ (2gj3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970630Species Azotobacter vinelandii [TaxId:354] [187754] (1 PDB entry)
  8. 2970631Domain d2gj3a_: 2gj3 A: [164728]
    automated match to d1n9na_
    complexed with eoh, fad, so4

Details for d2gj3a_

PDB Entry: 2gj3 (more details), 1.04 Å

PDB Description: crystal structure of the fad-containing pas domain of the protein nifl from azotobacter vinelandii.
PDB Compounds: (A:) Nitrogen fixation regulatory protein

SCOPe Domain Sequences for d2gj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj3a_ d.110.3.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
llpeifrqtvehapiaisitdlkanilyanrafrtitgygseevlgknesilsngttprl
vyqalwgrlaqkkpwsgvlvnrrkdktlylaeltvapvlneagetiyylgmhrdtselh

SCOPe Domain Coordinates for d2gj3a_:

Click to download the PDB-style file with coordinates for d2gj3a_.
(The format of our PDB-style files is described here.)

Timeline for d2gj3a_: