Lineage for d2gigb_ (2gig B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882542Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
    automatically mapped to Pfam PF09226
  6. 2882543Protein Restriction endonuclease HincII [69526] (1 species)
  7. 2882544Species Haemophilus influenzae [TaxId:727] [69527] (19 PDB entries)
    Uniprot P17743 ! Uniprot P44413
  8. 2882552Domain d2gigb_: 2gig B: [164713]
    automated match to d1kc6a_
    protein/DNA complex; complexed with na

Details for d2gigb_

PDB Entry: 2gig (more details), 1.83 Å

PDB Description: alteration of sequence specificity of the type ii restriction endonuclease hincii through an indirect readout mechanism
PDB Compounds: (B:) Type II restriction enzyme HincII

SCOPe Domain Sequences for d2gigb_:

Sequence, based on SEQRES records: (download)

>d2gigb_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

Sequence, based on observed residues (ATOM records): (download)

>d2gigb_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvfeklvykflkenlsdltfkqyeylndlfmknpaiigheary
klfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrnisksa
fapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfksepse
lyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkkyi

SCOPe Domain Coordinates for d2gigb_:

Click to download the PDB-style file with coordinates for d2gigb_.
(The format of our PDB-style files is described here.)

Timeline for d2gigb_: