PDB entry 2gig

View 2gig on RCSB PDB site
Description: Alteration of sequence specificity of the type II restriction endonuclease HINCII through an indirect readout mechanism
Class: hydrolase/DNA
Keywords: Protein DNA complex, indirect readout, DNA intercalation, endonuclease, HYDROLASE-DNA COMPLEX
Deposited on 2006-03-28, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (128)
      • engineered (136)
      • conflict (171)
    Domains in SCOPe 2.08: d2giga_
  • Chain 'B':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (128)
      • engineered (136)
      • conflict (171)
    Domains in SCOPe 2.08: d2gigb_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*gp*c)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*gp*c)-3'
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gigA (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gigA (A:)
    sfikpiyqdinsiligqkvkrphaagepfeklvykflkenlsdltfkqyeylndlfmknp
    aiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldv
    ktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfa
    elfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidk
    fvkpfkkyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gigB (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gigB (B:)
    sfikpiyqdinsiligqkvfeklvykflkenlsdltfkqyeylndlfmknpaiigheary
    klfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrnisksa
    fapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfksepse
    lyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkkyi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.