Lineage for d1aoif_ (1aoi F:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440358Protein Histone H4 [47125] (4 species)
  7. 440359Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)
  8. 440391Domain d1aoif_: 1aoi F: [16471]
    Other proteins in same PDB: d1aoia_, d1aoic_, d1aoid_, d1aoie_, d1aoig_, d1aoih_

Details for d1aoif_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoif_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)}
krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1aoif_:

Click to download the PDB-style file with coordinates for d1aoif_.
(The format of our PDB-style files is described here.)

Timeline for d1aoif_: