SCOP 1.69: Domain d1aoie_: 1aoi E:

Lineage for d1aoie_ (1aoi E:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries)

8. Domain d1aoie_: 1aoi E: [16463]
   Other proteins in same PDB: d1aoib_, d1aoic_, d1aoid_, d1aoif_, d1aoig_, d1aoih_

Details for d1aoie_

PDB Entry: 1aoi, 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoie_:

Sequence; same for both SEQRES and ATOM records:

>d1aoie_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk
tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1aoie_:

• d1aoie_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoie_ appears in SCOP 1.67
  
• d1aoie_ appears in SCOP 1.71
  
• d1aoie_ appears in the current release, SCOPe 2.08