Class a: All alpha proteins [46456] (218 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (3 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries) |
Domain d1aoie_: 1aoi E: [16463] Other proteins in same PDB: d1aoib_, d1aoic_, d1aoid_, d1aoif_, d1aoig_, d1aoih_ |
PDB Entry: 1aoi (more details), 2.8 Å
SCOP Domain Sequences for d1aoie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoie_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)} latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1aoie_: