Lineage for d1aoih_ (1aoi H:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440250Protein Histone H2B [47119] (3 species)
  7. 440251Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 440285Domain d1aoih_: 1aoi H: [16453]
    Other proteins in same PDB: d1aoia_, d1aoib_, d1aoic_, d1aoie_, d1aoif_, d1aoig_

Details for d1aoih_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoih_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1aoih_:

Click to download the PDB-style file with coordinates for d1aoih_.
(The format of our PDB-style files is described here.)

Timeline for d1aoih_: