![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries) Uniprot P62801 |
![]() | Domain d2hiod_: 2hio D: [16468] Other proteins in same PDB: d2hioa_, d2hiob_, d2hioc_ |
PDB Entry: 2hio (more details), 3.1 Å
SCOPe Domain Sequences for d2hiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam dvvyalkrqertlygfgg
Timeline for d2hiod_: