| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (4 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries) |
| Domain d1eqzd_: 1eqz D: [16466] Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_ |
PDB Entry: 1eqz (more details), 2.5 Å
SCOP Domain Sequences for d1eqzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqzd_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
gakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyt
ehakrktvtamdvvyalkrqgrtlygfgg
Timeline for d1eqzd_: