SCOP 1.63: Domain d1eqzh_: 1eqz H:

Lineage for d1eqzh_ (1eqz H:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)

8. Domain d1eqzh_: 1eqz H: [16467]
   Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_
   protein/DNA complex; complexed with cac, cl, k, mn; mutant

Details for d1eqzh_

PDB Entry: 1eqz, 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzh_:

Sequence; same for both SEQRES and ATOM records:

>d1eqzh_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
kglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvir
davtytehakrktvtamdvvyalkrqgrtlygfgg

Timeline for d1eqzh_:

• d1eqzh_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqzh_ appears in SCOP 1.61
  
• d1eqzh_ appears in SCOP 1.65
  
• d1eqzh_ appears in the current release, SCOPe 2.08