Lineage for d1hq3h_ (1hq3 H:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151060Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 151110Protein Histone H4 [47125] (4 species)
  7. 151117Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)
  8. 151119Domain d1hq3h_: 1hq3 H: [16465]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3c_, d1hq3e_, d1hq3f_, d1hq3g_

Details for d1hq3h_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3h_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1hq3h_:

Click to download the PDB-style file with coordinates for d1hq3h_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3h_: