Lineage for d1hq3b_ (1hq3 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151060Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 151078Protein Histone H2B [47119] (3 species)
  7. 151087Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries)
  8. 151088Domain d1hq3b_: 1hq3 B: [16444]
    Other proteins in same PDB: d1hq3a_, d1hq3c_, d1hq3d_, d1hq3e_, d1hq3g_, d1hq3h_

Details for d1hq3b_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3b_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytss

SCOP Domain Coordinates for d1hq3b_:

Click to download the PDB-style file with coordinates for d1hq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3b_: