Lineage for d1aoie_ (1aoi E:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353183Protein Histone H3 [47122] (3 species)
  7. 353184Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries)
  8. 353218Domain d1aoie_: 1aoi E: [16463]
    Other proteins in same PDB: d1aoib_, d1aoic_, d1aoid_, d1aoif_, d1aoig_, d1aoih_
    protein/DNA complex; complexed with mn; mutant

Details for d1aoie_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoie_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk
tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1aoie_:

Click to download the PDB-style file with coordinates for d1aoie_.
(The format of our PDB-style files is described here.)

Timeline for d1aoie_: