Lineage for d1f66e_ (1f66 E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46341Protein Histone H3 [47122] (2 species)
  7. 46342Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (2 PDB entries)
  8. 46344Domain d1f66e_: 1f66 E: [16461]
    Other proteins in same PDB: d1f66b_, d1f66c_, d1f66d_, d1f66f_, d1f66g_, d1f66h_

Details for d1f66e_

PDB Entry: 1f66 (more details), 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f66e_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
gevkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1f66e_:

Click to download the PDB-style file with coordinates for d1f66e_.
(The format of our PDB-style files is described here.)

Timeline for d1f66e_: