Lineage for d1f66h_ (1f66 H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46328Protein Histone H2B [47119] (2 species)
  7. 46329Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (2 PDB entries)
  8. 46331Domain d1f66h_: 1f66 H: [16451]
    Other proteins in same PDB: d1f66a_, d1f66b_, d1f66c_, d1f66e_, d1f66f_, d1f66g_

Details for d1f66h_

PDB Entry: 1f66 (more details), 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f66h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1f66h_:

Click to download the PDB-style file with coordinates for d1f66h_.
(The format of our PDB-style files is described here.)

Timeline for d1f66h_: