Lineage for d1f66e_ (1f66 E:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H3 [47122] (2 species) 
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (2 PDB entries) 
Domain d1f66e_: 1f66 E: [16461]
Other proteins in same PDB: d1f66b_, d1f66c_, d1f66d_, d1f66f_, d1f66g_, d1f66h_
Details for d1f66e_
PDB Entry: 1f66 (more details), 2.6 Å
PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
SCOP Domain Sequences for d1f66e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66e_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
gevkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
SCOP Domain Coordinates for d1f66e_:
Click to download the PDB-style file with coordinates for d1f66e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f66e_:
- d1f66e_ appears in SCOP 1.57
- d1f66e_ appears in the current release, SCOPe 2.08
View in 3D
