Lineage for d2hioc_ (2hio C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987456Protein Histone H3 [47122] (6 species)
  7. 1987540Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (6 PDB entries)
    Uniprot P84229
  8. 1987549Domain d2hioc_: 2hio C: [16458]
    Other proteins in same PDB: d2hioa_, d2hiob_, d2hiod_

Details for d2hioc_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein
PDB Compounds: (C:) protein (histone h3)

SCOPe Domain Sequences for d2hioc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hioc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
lfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2hioc_:

Click to download the PDB-style file with coordinates for d2hioc_.
(The format of our PDB-style files is described here.)

Timeline for d2hioc_: