| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (5 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (5 PDB entries) Uniprot P84229 |
| Domain d2hioc_: 2hio C: [16458] Other proteins in same PDB: d2hioa_, d2hiob_, d2hiod_ |
PDB Entry: 2hio (more details), 3.1 Å
SCOPe Domain Sequences for d2hioc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hioc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
lfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2hioc_: