| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (5 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries) Uniprot P84229 |
| Domain d1hq3g_: 1hq3 G: [16455] Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3d_, d1hq3e_, d1hq3f_, d1hq3h_ complexed with cl, po4 |
PDB Entry: 1hq3 (more details), 2.15 Å
SCOP Domain Sequences for d1hq3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hq3g_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1hq3g_: