Lineage for d1hq3g_ (1hq3 G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909423Protein Histone H3 [47122] (5 species)
  7. 909505Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (5 PDB entries)
    Uniprot P84229
  8. 909509Domain d1hq3g_: 1hq3 G: [16455]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3d_, d1hq3e_, d1hq3f_, d1hq3h_
    complexed with cl, po4

Details for d1hq3g_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate
PDB Compounds: (G:) histone h3

SCOPe Domain Sequences for d1hq3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3g_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1hq3g_:

Click to download the PDB-style file with coordinates for d1hq3g_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3g_: