SCOPe 2.08: Domain d2g0nb1: 2g0n B:1-177

Lineage for d2g0nb1 (2g0n B:1-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2g0nb1: 2g0n B:1-177 [164536]
   Other proteins in same PDB: d2g0na2, d2g0na3, d2g0nb2
   automated match to d2c2ha1
   complexed with cl, gdp, mg

Details for d2g0nb1

PDB Entry: 2g0n, 1.9 Å

PDB Description: The Crystal Structure of the Human RAC3 in complex with GDP and Chloride

PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2g0nb1:

Sequence; same for both SEQRES and ATOM records:

>d2g0nb1 c.37.1.8 (B:1-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Timeline for d2g0nb1:

• d2g0nb1 first appeared in SCOPe 2.01, called d2g0nb_
  
• d2g0nb1 appears in SCOPe 2.07