Lineage for d1aoid_ (1aoi D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637507Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)
  8. 637540Domain d1aoid_: 1aoi D: [16452]
    Other proteins in same PDB: d1aoia_, d1aoib_, d1aoic_, d1aoie_, d1aoif_, d1aoig_

Details for d1aoid_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
PDB Compounds: (D:) histone h2b

SCOP Domain Sequences for d1aoid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoid_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1aoid_:

Click to download the PDB-style file with coordinates for d1aoid_.
(The format of our PDB-style files is described here.)

Timeline for d1aoid_: