Class a: All alpha proteins [46456] (285 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) |
Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins) automatically mapped to Pfam PF00887 |
Protein automated matches [190551] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries) |
Domain d2fj9a_: 2fj9 A: [164403] automated match to d1acaa_ complexed with cl, pb, zn |
PDB Entry: 2fj9 (more details), 1.6 Å
SCOPe Domain Sequences for d2fj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj9a_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawne lkgtskedamkayinkveelkkkygi
Timeline for d2fj9a_: