Lineage for d2fj9a_ (2fj9 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725170Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1725171Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 1725184Protein automated matches [190551] (1 species)
    not a true protein
  7. 1725185Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)
  8. 1725188Domain d2fj9a_: 2fj9 A: [164403]
    automated match to d1acaa_
    complexed with cl, pb, zn

Details for d2fj9a_

PDB Entry: 2fj9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of the unliganded human acbp
PDB Compounds: (A:) acyl-coa-binding protein

SCOPe Domain Sequences for d2fj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj9a_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawne
lkgtskedamkayinkveelkkkygi

SCOPe Domain Coordinates for d2fj9a_:

Click to download the PDB-style file with coordinates for d2fj9a_.
(The format of our PDB-style files is described here.)

Timeline for d2fj9a_: