Lineage for d2feps_ (2fep S:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035733Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1035734Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1035735Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 1035752Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)
  7. 1035761Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries)
  8. 1035765Domain d2feps_: 2fep S: [164339]
    automated match to d1kklj_
    complexed with so4

Details for d2feps_

PDB Entry: 2fep (more details), 2.45 Å

PDB Description: Structure of truncated CcpA in complex with P-Ser-HPr and Sulfate ions
PDB Compounds: (S:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2feps_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feps_ d.94.1.1 (S:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
tisasgadendalnaleetmkseglge

SCOPe Domain Coordinates for d2feps_:

Click to download the PDB-style file with coordinates for d2feps_.
(The format of our PDB-style files is described here.)

Timeline for d2feps_: