PDB entry 2fep

View 2fep on RCSB PDB site
Description: Structure of truncated CcpA in complex with P-Ser-HPr and Sulfate ions
Class: transcription
Keywords: CcpA, HPr, transcriptional regulator
Deposited on 2005-12-16, released 2006-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite control protein A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ccpA, alsA, amyR, graR
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (1-87)
      • modified residue (45)
    Domains in SCOPe 2.01: d2feps_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download) 
    >2fepS (S:)
maqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgae
itisasgadendalnaleetmkseglge

    Sequence, based on observed residues (ATOM records): (download) 
    >2fepS (S:)
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
tisasgadendalnaleetmkseglge