SCOPe 2.08: Domain d2fa9b_: 2fa9 B:

Lineage for d2fa9b_ (2fa9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [187100] (2 PDB entries)

8. Domain d2fa9b_: 2fa9 B: [164310]
   automated match to d1f6ba_
   complexed with gdp, mg, so4

Details for d2fa9b_

PDB Entry: 2fa9, 2.5 Å

PDB Description: the crystal structure of sar1[h79g]-gdp provides insight into the coat-controlled gtp hydrolysis in the disassembly of cop ii

PDB Compounds: (B:) GTP-binding protein SAR1b

SCOPe Domain Sequences for d2fa9b_:

Sequence, based on SEQRES records:

>d2fa9b_ c.37.1.8 (B:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlgggiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil
gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw
maqyid

Sequence, based on observed residues (ATOM records):

>d2fa9b_ c.37.1.8 (B:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkptlhptseeltiagmtfttfdlgggi
qarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpe
aiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid

Timeline for d2fa9b_:

• d2fa9b_ first appeared in SCOPe 2.01
  
• d2fa9b_ appears in SCOPe 2.07