Lineage for d2f8qa_ (2f8q A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819412Protein automated matches [190057] (21 species)
    not a true protein
  7. 1819426Species Bacillus sp. [TaxId:65673] [187690] (5 PDB entries)
  8. 1819431Domain d2f8qa_: 2f8q A: [164282]
    automated match to d1hiza_
    complexed with mg

Details for d2f8qa_

PDB Entry: 2f8q (more details), 2.2 Å

PDB Description: an alkali thermostable f/10 xylanase from alkalophilic bacillus sp. ng-27
PDB Compounds: (A:) alkaline thermostable endoxylanase

SCOPe Domain Sequences for d2f8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8qa_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]}
qpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpeeg
vftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqankel
llerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafet
arkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptidei
rtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyeel
dadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

SCOPe Domain Coordinates for d2f8qa_:

Click to download the PDB-style file with coordinates for d2f8qa_.
(The format of our PDB-style files is described here.)

Timeline for d2f8qa_: