SCOPe 2.02: Domain d2f51b_: 2f51 B:

Lineage for d2f51b_ (2f51 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (14 species)

7. Species Trichomonas vaginalis [TaxId:5722] [187687] (1 PDB entry)

8. Domain d2f51b_: 2f51 B: [164270]
   automated match to d1syra_

Details for d2f51b_

PDB Entry: 2f51, 1.9 Å

PDB Description: Structure of Trichomonas vaginalis thioredoxin

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d2f51b_:

Sequence; same for both SEQRES and ATOM records:

>d2f51b_ c.47.1.1 (B:) Thioredoxin {Trichomonas vaginalis [TaxId: 5722]}
sdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikvd
vdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfk

Timeline for d2f51b_:

• d2f51b_ first appeared in SCOPe 2.01
  
• d2f51b_ appears in SCOPe 2.03
  
• d2f51b_ appears in the current release, SCOPe 2.08, called d2f51b1