Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (14 species) |
Species Trichomonas vaginalis [TaxId:5722] [187687] (1 PDB entry) |
Domain d2f51b_: 2f51 B: [164270] automated match to d1syra_ |
PDB Entry: 2f51 (more details), 1.9 Å
SCOPe Domain Sequences for d2f51b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f51b_ c.47.1.1 (B:) Thioredoxin {Trichomonas vaginalis [TaxId: 5722]} sdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikvd vdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfk
Timeline for d2f51b_: