Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (18 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [187324] (7 PDB entries) |
Domain d2e6aa_: 2e6a A: [163850] automated match to d2b4ga1 complexed with fmn, gol, nco, oro |
PDB Entry: 2e6a (more details), 1.64 Å
SCOPe Domain Sequences for d2e6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e6aa_ c.1.4.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr tleefrgrvkti
Timeline for d2e6aa_: