SCOPe 2.06: Domain d2e6aa_: 2e6a A:

Lineage for d2e6aa_ (2e6a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (18 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [187324] (7 PDB entries)

8. Domain d2e6aa_: 2e6a A: [163850]
   automated match to d2b4ga1
   complexed with fmn, gol, nco, oro

Details for d2e6aa_

PDB Entry: 2e6a, 1.64 Å

PDB Description: Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate

PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2e6aa_:

Sequence; same for both SEQRES and ATOM records:

>d2e6aa_ c.1.4.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvkti

Timeline for d2e6aa_:

• d2e6aa_ first appeared in SCOPe 2.01
  
• d2e6aa_ appears in SCOPe 2.05
  
• d2e6aa_ appears in SCOPe 2.07
  
• d2e6aa_ appears in the current release, SCOPe 2.08