Class a: All alpha proteins [46456] (226 folds) |
Fold a.13: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47044] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, partly opened |
Superfamily a.13.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47045] (1 family) |
Family a.13.1.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47046] (1 protein) |
Protein alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47048] (4 PDB entries) |
Domain d1nre__: 1nre - [16377] |
PDB Entry: 1nre (more details)
SCOP Domain Sequences for d1nre__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nre__ a.13.1.1 (-) alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 {Human (Homo sapiens)} geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear lirnlnvilakygldgkkdar
Timeline for d1nre__: