SCOP 1.71: Domain d1nre__: 1nre -

Lineage for d1nre__ (1nre -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.13: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47044] (1 superfamily)
   3 helices, the first one is shorter than the other two; bundle, partly opened

4. Superfamily a.13.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47045] (1 family)

5. Family a.13.1.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47046] (1 protein)

6. Protein alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47048] (4 PDB entries)

8. Domain d1nre__: 1nre - [16377]

Details for d1nre__

PDB Entry: 1nre

PDB Description: receptor associated protein (rap) domain 1, nmr, minimized average structure

SCOP Domain Sequences for d1nre__:

Sequence; same for both SEQRES and ATOM records:

>d1nre__ a.13.1.1 (-) alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 {Human (Homo sapiens)}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar

Timeline for d1nre__:

• d1nre__ first appeared (with stable ids) in SCOP 1.55
  
• d1nre__ appears in SCOP 1.69
  
• d1nre__ is called d1nrea_ in SCOP 1.73
  
• d1nre__ appears in the current release, SCOPe 2.08, called d1nrea_