| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.13: RAP domain-like [47044] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, partly opened |
Superfamily a.13.1: RAP domain-like [47045] (1 family) ![]() |
| Family a.13.1.1: RAP domain [47046] (1 protein) |
| Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries) |
| Domain d1nrea_: 1nre A: [16377] |
PDB Entry: 1nre (more details)
SCOPe Domain Sequences for d1nrea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrea_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar
Timeline for d1nrea_: