Lineage for d1nre__ (1nre -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1984Fold a.13: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47044] (1 superfamily)
  4. 1985Superfamily a.13.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47045] (1 family) (S)
  5. 1986Family a.13.1.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47046] (1 protein)
  6. 1987Protein alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47047] (1 species)
  7. 1988Species Human (Homo sapiens) [TaxId:9606] [47048] (2 PDB entries)
  8. 1990Domain d1nre__: 1nre - [16377]

Details for d1nre__

PDB Entry: 1nre (more details)

PDB Description: receptor associated protein (rap) domain 1, nmr, minimized average structure

SCOP Domain Sequences for d1nre__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nre__ a.13.1.1 (-) alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 {Human (Homo sapiens)}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar

SCOP Domain Coordinates for d1nre__:

Click to download the PDB-style file with coordinates for d1nre__.
(The format of our PDB-style files is described here.)

Timeline for d1nre__: