Lineage for d2dvwa_ (2dvw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612405Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species)
  7. 2612412Species Mouse (Mus musculus) [TaxId:10090] [187642] (2 PDB entries)
  8. 2612413Domain d2dvwa_: 2dvw A: [163728]
    automated match to d1tr4a_

Details for d2dvwa_

PDB Entry: 2dvw (more details), 2.3 Å

PDB Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d2dvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvwa_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Mouse (Mus musculus) [TaxId: 10090]}
gcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllql
gvpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheia
vmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacde
erveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm

SCOPe Domain Coordinates for d2dvwa_:

Click to download the PDB-style file with coordinates for d2dvwa_.
(The format of our PDB-style files is described here.)

Timeline for d2dvwa_: