PDB entry 2dvw

View 2dvw on RCSB PDB site
Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
Class: cell cycle/protein-binding
Keywords: ANKYRIN REPEATS, A-HELICAL DOMAIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE/PROTEIN-BINDING COMPLEX
Deposited on 2006-08-01, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 10
    Species: Mus musculus [TaxId:10090]
    Gene: Psmd10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dvwa_
  • Chain 'B':
    Compound: 26S protease regulatory subunit 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMC4, TBP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43686 (1-End)
      • cloning artifact (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2dvwA (A:)
megcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefll
qlgvpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrhe
iavmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlac
deerveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm

    Sequence, based on observed residues (ATOM records): (download) 
    >2dvwA (A:)
gcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllql
gvpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheia
vmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacde
erveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm

  • Chain 'B':
    No sequence available.