Lineage for d2dukb_ (2duk B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666148Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1666149Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1666150Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1666290Protein automated matches [190465] (3 species)
    not a true protein
  7. 1666322Species Mouse (Mus musculus) [TaxId:10090] [187640] (1 PDB entry)
  8. 1666324Domain d2dukb_: 2duk B: [163706]
    automated match to d2fvva1

Details for d2dukb_

PDB Entry: 2duk (more details), 2.62 Å

PDB Description: Crystal structure of MS0616
PDB Compounds: (B:) ms0616

SCOPe Domain Sequences for d2dukb_:

Sequence, based on SEQRES records: (download)

>d2dukb_ d.113.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwedsvnigrkrewfkvedaikv
lqchkpvhaeyleklklg

Sequence, based on observed residues (ATOM records): (download)

>d2dukb_ d.113.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwgrkrewfkvedaikvlqchkp
vhaeyleklklg

SCOPe Domain Coordinates for d2dukb_:

Click to download the PDB-style file with coordinates for d2dukb_.
(The format of our PDB-style files is described here.)

Timeline for d2dukb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2duka_