SCOPe 2.03: Domain d2dukb_: 2duk B:

Lineage for d2dukb_ (2duk B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187640] (1 PDB entry)

8. Domain d2dukb_: 2duk B: [163706]
   automated match to d2fvva1

Details for d2dukb_

PDB Entry: 2duk, 2.62 Å

PDB Description: Crystal structure of MS0616

PDB Compounds: (B:) ms0616

SCOPe Domain Sequences for d2dukb_:

Sequence, based on SEQRES records:

>d2dukb_ d.113.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwedsvnigrkrewfkvedaikv
lqchkpvhaeyleklklg

Sequence, based on observed residues (ATOM records):

>d2dukb_ d.113.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevy
eeagvkgklgrllgifenqdrkhrtyvyvltvteiledwgrkrewfkvedaikvlqchkp
vhaeyleklklg

Timeline for d2dukb_:

• d2dukb_ first appeared in SCOPe 2.01
  
• d2dukb_ appears in SCOPe 2.02
  
• d2dukb_ appears in SCOPe 2.04
  
• d2dukb_ appears in the current release, SCOPe 2.08