Lineage for d2dt8a_ (2dt8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168927Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2168928Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2168975Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2168976Protein automated matches [190655] (10 species)
    not a true protein
  7. 2169004Species Thermus thermophilus HB8 [TaxId:300852] [188541] (1 PDB entry)
  8. 2169005Domain d2dt8a_: 2dt8 A: [163686]
    automated match to d1mgpa_
    complexed with gol, plm, zn

Details for d2dt8a_

PDB Entry: 2dt8 (more details), 1.48 Å

PDB Description: Fatty Acid Binding of a DegV family Protein from Thermus thermophilus
PDB Compounds: (A:) DegV family protein

SCOPe Domain Sequences for d2dt8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dt8a_ c.119.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mritlvtdstsdlpqdlrgrlgvrvvplyvnlsgaiyrdweeitpteifqkvregaafpt
tsqpspedfarvyrealeeadhvlslhisgklsgtvqsaelaaqefpgrvtvvdtqaasl
gvgmmvlrakelleegqsleavlaelerlrrdhfvrfsvatleflkrggriggaqaflgt
llnlkpvltlkegrveaagrargekkareeilkafrawaegrkrirayflysgdedavaa
lrqevlasglpveealvnelgaviashtgpgtygfyaysl

SCOPe Domain Coordinates for d2dt8a_:

Click to download the PDB-style file with coordinates for d2dt8a_.
(The format of our PDB-style files is described here.)

Timeline for d2dt8a_: