Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
Family c.119.1.0: automated matches [191443] (1 protein) not a true family |
Protein automated matches [190655] (10 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188541] (1 PDB entry) |
Domain d2dt8a_: 2dt8 A: [163686] automated match to d1mgpa_ complexed with gol, plm, zn |
PDB Entry: 2dt8 (more details), 1.48 Å
SCOPe Domain Sequences for d2dt8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dt8a_ c.119.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mritlvtdstsdlpqdlrgrlgvrvvplyvnlsgaiyrdweeitpteifqkvregaafpt tsqpspedfarvyrealeeadhvlslhisgklsgtvqsaelaaqefpgrvtvvdtqaasl gvgmmvlrakelleegqsleavlaelerlrrdhfvrfsvatleflkrggriggaqaflgt llnlkpvltlkegrveaagrargekkareeilkafrawaegrkrirayflysgdedavaa lrqevlasglpveealvnelgaviashtgpgtygfyaysl
Timeline for d2dt8a_: