SCOPe 2.08: Domain d2dt8a_: 2dt8 A:

Lineage for d2dt8a_ (2dt8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188541] (1 PDB entry)

8. Domain d2dt8a_: 2dt8 A: [163686]
   automated match to d1mgpa_
   complexed with gol, plm, zn

Details for d2dt8a_

PDB Entry: 2dt8, 1.48 Å

PDB Description: Fatty Acid Binding of a DegV family Protein from Thermus thermophilus

PDB Compounds: (A:) DegV family protein

SCOPe Domain Sequences for d2dt8a_:

Sequence; same for both SEQRES and ATOM records:

>d2dt8a_ c.119.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mritlvtdstsdlpqdlrgrlgvrvvplyvnlsgaiyrdweeitpteifqkvregaafpt
tsqpspedfarvyrealeeadhvlslhisgklsgtvqsaelaaqefpgrvtvvdtqaasl
gvgmmvlrakelleegqsleavlaelerlrrdhfvrfsvatleflkrggriggaqaflgt
llnlkpvltlkegrveaagrargekkareeilkafrawaegrkrirayflysgdedavaa
lrqevlasglpveealvnelgaviashtgpgtygfyaysl

Timeline for d2dt8a_:

• d2dt8a_ first appeared in SCOPe 2.01
  
• d2dt8a_ appears in SCOPe 2.07