SCOPe 2.01: Domain d2dgkb_: 2dgk B:

Lineage for d2dgkb_ (2dgk B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)

6. Protein Glutamate decarboxylase beta, GadB [102596] (2 species)

7. Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)

8. Domain d2dgkb_: 2dgk B: [163632]
   automated match to d1pmoa_
   complexed with edo, plp, so4; mutant

Details for d2dgkb_

PDB Entry: 2dgk, 1.9 Å

PDB Description: Crystal structure of an N-terminal deletion mutant of Escherichia coli GadB in an autoinhibited state (aldamine)

PDB Compounds: (B:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dgkb_:

Sequence; same for both SEQRES and ATOM records:

>d2dgkb_ c.67.1.6 (B:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
skrfplhemrddvafqiindelyldgnarqnlatfcqtwddenvhklmdlsinknwidke
eypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacmlggmamkwrwrkrmeaa
gkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpkrmieacdentigvvpt
fgvtytgnyefpqplhdaldkfqadtgididmhidaasggflapfvapdivwdfrlprvk
sisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigtfainfsrpagqviaqy
yeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpdegipavcfklkdgedp
gytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemdfaellledykaslkyl
sdhpklqgiaqqnsfkht

Timeline for d2dgkb_:

• d2dgkb_ is new in SCOPe 2.01-stable
  
• d2dgkb_ appears in SCOPe 2.02
  
• d2dgkb_ appears in the current release, SCOPe 2.08