Lineage for d2dgkb_ (2dgk B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1177915Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
  6. 1177926Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1177940Species Escherichia coli [TaxId:562] [102597] (5 PDB entries)
  8. 1177948Domain d2dgkb_: 2dgk B: [163632]
    automated match to d1pmoa_
    complexed with edo, plp, so4; mutant

Details for d2dgkb_

PDB Entry: 2dgk (more details), 1.9 Å

PDB Description: Crystal structure of an N-terminal deletion mutant of Escherichia coli GadB in an autoinhibited state (aldamine)
PDB Compounds: (B:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d2dgkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgkb_ c.67.1.6 (B:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]}
skrfplhemrddvafqiindelyldgnarqnlatfcqtwddenvhklmdlsinknwidke
eypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacmlggmamkwrwrkrmeaa
gkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpkrmieacdentigvvpt
fgvtytgnyefpqplhdaldkfqadtgididmhidaasggflapfvapdivwdfrlprvk
sisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigtfainfsrpagqviaqy
yeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpdegipavcfklkdgedp
gytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemdfaellledykaslkyl
sdhpklqgiaqqnsfkht

SCOPe Domain Coordinates for d2dgkb_:

Click to download the PDB-style file with coordinates for d2dgkb_.
(The format of our PDB-style files is described here.)

Timeline for d2dgkb_: