SCOPe 2.08: Domain d2d0ka_: 2d0k A:

Lineage for d2d0ka_ (2d0k A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187587] (3 PDB entries)

8. Domain d2d0ka_: 2d0k A: [163534]
   automated match to d1ddra_
   complexed with cl, fol; mutant

Details for d2d0ka_

PDB Entry: 2d0k, 1.9 Å

PDB Description: methionine-free mutant of escherichia coli dihydrofolate reductase

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2d0ka_:

Sequence; same for both SEQRES and ATOM records:

>d2d0ka_ c.71.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aisliaalavdrvignenalpwnlpadlawfkrntlnkpviygrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaaagdvpeifvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsysfeilerr

Timeline for d2d0ka_:

• d2d0ka_ first appeared in SCOPe 2.01
  
• d2d0ka_ appears in SCOPe 2.07