![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187587] (3 PDB entries) |
![]() | Domain d2d0kb_: 2d0k B: [163535] automated match to d1ddra_ complexed with cl, fol; mutant |
PDB Entry: 2d0k (more details), 1.9 Å
SCOPe Domain Sequences for d2d0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0kb_ c.71.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} aisliaalavdrvignenalpwnlpadlawfkrntlnkpviygrhtwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaaagdvpeifvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsysfeilerr
Timeline for d2d0kb_: