Lineage for d2cunb_ (2cun B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007123Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1007124Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1007190Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 1007191Protein automated matches [190573] (2 species)
    not a true protein
  7. 1007195Species Pyrococcus horikoshii [TaxId:70601] [187569] (1 PDB entry)
  8. 1007197Domain d2cunb_: 2cun B: [163472]
    automated match to d1vpea_
    complexed with 3pg, cl, gol, mpd

Details for d2cunb_

PDB Entry: 2cun (more details), 2.1 Å

PDB Description: Crystal structure of Phosphoglycerate Kinase from Pyrococcus horikoshii OT3
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d2cunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cunb_ c.86.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrledfnfhnktvflrvdlnspmkdgkiisdarfkavlptiryliesgakvvigthqgk
pysedyttteeharvlselldqhveyiedifgryarekikelksgevailenlrfsaeev
knkpieecektflvkklskvidyvvndafatahrsqpslvgfarikpmimgflmekeiea
lmrayyskdspkiyvlggakvedslkvvenvlrreradlvltgglvanvftlakgfdlgr
knvefmkkkglldyvkhaeeildefypyirtpvdfavdykgerveidllsenrgllhqyq
imdigkrtaekyreilmkariivangpmgvfereefaigtvevfkaiadspafsvlgggh
siasiqkygitgithistgggamlsffageelpvlralqisyekf

SCOPe Domain Coordinates for d2cunb_:

Click to download the PDB-style file with coordinates for d2cunb_.
(The format of our PDB-style files is described here.)

Timeline for d2cunb_: