SCOPe 2.01: Domain d2cuna_: 2cun A:

Lineage for d2cuna_ (2cun A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has parallel beta-sheet of 6 strands, order 342156
   Domain 2 has parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families)

5. Family c.86.1.0: automated matches [191414] (1 protein)
   not a true family

6. Protein automated matches [190573] (2 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187569] (1 PDB entry)

8. Domain d2cuna_: 2cun A: [163471]
   automated match to d1vpea_
   complexed with 3pg, cl, gol, mpd

Details for d2cuna_

PDB Entry: 2cun, 2.1 Å

PDB Description: Crystal structure of Phosphoglycerate Kinase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d2cuna_:

Sequence; same for both SEQRES and ATOM records:

>d2cuna_ c.86.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrledfnfhnktvflrvdlnspmkdgkiisdarfkavlptiryliesgakvvigthqgk
pysedyttteeharvlselldqhveyiedifgryarekikelksgevailenlrfsaeev
knkpieecektflvkklskvidyvvndafatahrsqpslvgfarikpmimgflmekeiea
lmrayyskdspkiyvlggakvedslkvvenvlrreradlvltgglvanvftlakgfdlgr
knvefmkkkglldyvkhaeeildefypyirtpvdfavdykgerveidllsenrgllhqyq
imdigkrtaekyreilmkariivangpmgvfereefaigtvevfkaiadspafsvlgggh
siasiqkygitgithistgggamlsffageelpvlralqisyekf

Timeline for d2cuna_:

• d2cuna_ is new in SCOPe 2.01-stable
  
• d2cuna_ appears in SCOPe 2.02
  
• d2cuna_ appears in the current release, SCOPe 2.08